Fragment designation raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2025-12-12. Anything still debated is marked as such rather than presented as settled.
Physical descriptions in supplier documents and papers usually list the compound as a white to off-white powder. It dissolves readily in water and in common aqueous buffers, and solutions are often prepared fresh before an experiment. Molecular mass near 1419 daltons helps verify identity during mass spectrometry. The powder is somewhat hygroscopic, so moisture exposure can alter the measured mass of a sample. Purity is typically reported as a percentage from chromatographic analysis.
BPC-157 is a synthetic fifteen-amino-acid peptide whose sequence is GEPPPGKPADDAGLV. Its name derives from the phrase body protection compound, a term applied to a protein fraction originally detected in human gastric juice. The short peptide is not that full protein; it corresponds to a stable fragment of the larger molecule. Researchers frequently describe it as a pentadecapeptide because it contains exactly fifteen residues. Its neutral molecular mass is approximately 1419 daltons.
The sequence places several glycine and proline residues near the middle, which may influence how the chain folds in solution. The peptide is linear rather than cyclic, and it carries no disulfide bridges. Commercial material is commonly supplied as the acetate salt, although the free base and other counterion forms also appear. Because the term BPC-157 refers to a specific sequence, samples with slight sequence variants are chemically different substances. Published work generally treats the fifteen-residue sequence as the defining structure.
The sequence contains an unusually high proportion of proline and glycine, which limits regular secondary structure and contributes to solubility in aqueous media. The compound dissolves readily in water and in normal saline. Because it is a peptide, digestive enzymes are expected to break it down if it is swallowed, a consideration that influences the routes of administration used in animal experiments. Detailed conformational data remain limited, and published structural models are largely computational.
BPC 157 is a synthetic peptide built from fifteen amino acids. The letters stand for body protection compound, and the number is a laboratory code rather than a description of any biological feature. Its single-letter sequence is GEPPPGKPADDAGLV, which corresponds to a calculated mass near 1419.5 daltons. The material is produced by solid-phase peptide synthesis and is distributed as a lyophilized powder, not as a purified extract from a natural source.
Early work on this family of molecules examined fractions of human gastric juice, where a larger protein was reported to protect gastrointestinal tissue in animal models. BPC 157 was designed as a shorter, more stable fragment of that protein and then studied on its own. The peptide itself is not a normal dietary component and is not present in the human body in meaningful quantities. Descriptions of its origin therefore refer to the research lineage of a laboratory molecule rather than to an endogenous or nutritional substance.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C62H98N16O22 | Approximate, for sequence GEPPPGKPADDAGLV |
| Molecular mass | ~1419 Da | Neutral form |
| Appearance | White to off-white powder | Lyophilized solid |
| Solubility | Soluble in water | Also soluble in aqueous buffers |
| Typical storage | -20 C | Dry powder, protected from moisture |
Proposed mechanisms include interaction with the nitric oxide system, modulation of growth factor signaling, and effects on blood vessel formation. None of these has been established as the primary mode of action, and some proposed pathways rest on indirect measurements. Whether the reported effects depend on a specific receptor has not been determined. Stability in gastric acid, unusual for a peptide of this size, is also reported in animal work, but the reason for it is not firmly established.
Published studies on BPC-157 are dominated by animal models. Commonly used endpoints include healing of surgically induced lesions in the stomach, tendon-to-bone attachment after transection, and recovery from experimentally induced vascular or intestinal damage. Many of these reports come from a small number of research groups, and the peptide is often described as acting across a wide range of tissue types. That breadth is itself a point of discussion, since one molecule influencing many unrelated systems is unusual.
Human data are far more limited than animal data. A small number of clinical reports exist, generally with few participants and without the randomization or blinding expected in later-phase trials. No large, independently replicated human trial has appeared in the indexed peer-reviewed literature. Statements about effects in people therefore rest on extrapolation from animal work rather than on direct evidence, and the strength of that extrapolation remains an open question rather than a settled matter.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography with ultraviolet detection near 214 nanometers, a wavelength that captures the peptide backbone. The main peak area is reported as a percentage of total peak area, which serves as a conventional purity figure. Mass spectrometry provides an independent check on molecular mass and helps confirm the expected sequence. Additional tests may include amino acid analysis and water content determination. Results are only comparable when the same column, gradient, and detection settings are used.
Peptides are susceptible to hydrolysis, oxidation, and aggregation, and BPC-157 is no exception. The lyophilized powder form is generally more stable than a solution because residual moisture is low and molecular mobility is reduced. Once dissolved, the peptide is exposed to water, oxygen, and trace metal ions that accelerate degradation. Light exposure and repeated freeze-thaw cycles are also commonly cited as sources of loss. These general principles guide most handling recommendations found in supplier documentation.
Standard practice for the solid form is storage at minus twenty degrees Celsius or colder, kept dry and away from light. Containers are usually sealed with a desiccant to limit moisture uptake. Reconstituted solutions are typically held at two to eight degrees Celsius and used within a short window, because potency can decline over days to weeks depending on the buffer and concentration. Freezing an already dissolved sample may help, though repeated thawing is discouraged. Specific shelf-life claims vary between suppliers and are rarely supported by published stability studies.
Evidence in humans is limited. Small clinical studies have examined the peptide in contexts such as ulcerative colitis and wound healing, but participant numbers are small and independent replication is scarce. It is not approved as a medicine by major regulatory agencies and is distributed mainly as a research material or compounded preparation. Long-term human safety data are not established, and questions about absorption through non-injected routes remain open rather than resolved. Claims about its effects are best read against these gaps.
BPC-157 is a synthetic peptide of fifteen amino acids, written in single-letter code as GEPPPGKPADDAGLV. The sequence corresponds to a partial fragment of a protein isolated from human gastric juice, described in early reports as body protection compound. The number 157 refers to a fragment designation in that work rather than to molecular mass. Initial descriptions appeared in the early 1990s, when the fragment was reported to protect gastrointestinal tissue in animal models. Commercial material is produced by solid-phase peptide synthesis rather than extracted from biological sources.
Laboratory research on this peptide has examined a wide and heterogeneous set of endpoints, including gastric ulcer models, tendon and ligament injury, wound closure, and intestinal inflammation. Most published findings come from rodent studies, and reported effect sizes are often large relative to controls. Because the compound has been tested across many unrelated injury models, the literature is frequently described as unusually broad for a single peptide. A substantial share of this work originates from a small number of research groups, which matters when assessing how widely results have been reproduced.
Most published findings come from rodent models, where the peptide has been examined in wound-healing, gastrointestinal-lesion, tendon, and vascular-injury preparations. A smaller number of early human studies have been reported, chiefly in inflammatory bowel conditions, but the public record is short and has not led to marketing approval in the United States or the European Union. Reviewers therefore classify the compound as investigational, and whether animal results carry over to people remains an open question rather than a settled one.
Outside laboratory supply channels, the peptide is sold as a research chemical, a category that carries no requirement to demonstrate purity, identity, or freedom from contamination. Because it is not an approved medicine, products labeled BPC-157 sit in a regulatory gap in many countries, and actual content may differ from the label. Sports organizations list it among prohibited substances, so its presence in an athlete's sample can produce a doping finding regardless of how the material was obtained.
BPC-157 is a synthetic peptide of fifteen amino acids, written as GEPPPGKPADDAGLV, whose sequence matches part of a larger protein identified in human gastric juice. That parent protein was described in stomach-secretion research, and the fifteen-residue fragment was named body protection compound, which gives the peptide its common label. Material used in experiments is produced by solid-phase peptide synthesis rather than extracted from tissue. The reported molecular weight is about 1419 daltons, and the chain contains several proline residues, a feature that appears in discussions of its resistance to enzymatic breakdown.
Guttenplan (1978), London correspondent and current editor of The Nation Michael Musto (1978), gossip columnist for The Village Voice Andrea di Robilant (1979), Italian journalist for La Stampa and professore Tim Weiner (1979), Pulitzer Prize-winning reporter for The New York Times specializing in national security matters Kevin Baker (1980), freelance journalist and novelist John Leland (1981), journalist for The New York Times Jason Zweig (1982), financial journalist and columnist for The Wall Street Journal Barry C. Lynn (1983), journalist, senior fellow at the New America Foundation Ashley Kahn (1983), Grammy-winning music historian, journalist, and producer Daniel Wattenberg (1983), journalist for The Washington Times, son of neoconservative pundit Ben J. Wattenberg N.J.
== Research == Stem cell therapy may represent a treatment for promoting the healing of diabetic foot ulcers. Diabetic foot ulcers develop their own, distinctive microbiota. Investigations into characterizing and identifying the phyla, genera, and species of nonpathogenic bacteria or other microorganisms populating these ulcers may help identify one group of microbiota that promotes healing. The recent advances in epigenetic modifications, with special focus on aberrant macrophage polarisation, are giving increasing evidence that epigenetic modifications might play a vital role in changing the treatment of diabetic foot ulcer in the near future.
Inhibitors of OATP1B1 may increase circulating levels of elagolix, and elagolix is considered to be contraindicated in combination with strong OATP1B1 inhibitors. Elagolix is a substrate of P-glycoprotein, but the effect of inhibitors and inducers of P-glycoprotein on the pharmacokinetics of elagolix is unknown. Elagolix itself is an inhibitor of P-glycoprotein.
=== Build === Though Neanderthals are often imagined as short and stocky, they were on average the same height as pre-industrial Europeans, or even slightly taller. The body mass index of the average European Neanderthal was comparable to 20th century Canadians and Americans. Neanderthal body size varied by location; West Asian Neanderthals were taller and more slightly built than European Neanderthals. In a sample of 45 Neanderthal long bones from 14 men and 7 women, the average height was 164 to 168 cm (5 ft 5 in to 5 ft 6 in) for males and 152 to 156 cm (5 ft 0 in to 5 ft 1 in) for females. The fossil record shows that adult Neanderthals varied from about 147.5 to 177 cm (4 ft 10 in to 5 ft 10 in) in height. The average male body mass index was 26.9–28.3. Neanderthal pelvic bones were extremely wide; with Neanderthal male hips being approximately 31% wider than those of modern humans males. As in all archaic species, there is no evidence of sexual dimorphism in the Neanderthal pelvis; both males and females had large pelvic bones relative to their body size, with larger males having the largest pelvises. The Neanderthal chest was deep and wide, with a proportionally expansive thoracic cavity, and possibly stronger lung performance. and much higher caloric demands. The limbs are proportionally short. The body plan has traditionally been explained as a "hyper-arctic" adaptation (Allen's rule). Neanderthals would also have been effective sprinters: stronger lungs, and shorter limbs would have boosted efficiency.
=== Cold advection aloft === One of the most effective erosion mechanisms is the import of colder air—also known as cold air advection—aloft. With cold advection maximized above the inversion layer, cooling aloft can weaken in the inversion layer, which allows for mixing and the demise of CAD. The Richardson number is reduced by the weakening inversion layer. Cold advection favors subsidence and drying, which supports solar heating beneath the inversion.
Sources: en.wikipedia.org
Acetyl-S-ACP:malonate ACP transferase (EC 2.3.1.187, acetyl-S-ACP:malonate ACP-SH transferase, acetyl-S-acyl-carrier protein:malonate acyl-carrier-protein-transferase, MdcA, MadA, ACP transferase, malonate/acetyl-CoA transferase, malonate:ACP transferase, acetyl-S-acyl carrier protein:malonate acyl carrier protein-SH transferase) is an enzyme with systematic name acetyl-(acyl-carrier-protein):malonate S-(acyl-carrier-protein)transferase. This enzyme catalyses the following chemical reaction
The plot of Black Mesa is almost identical to Half-Life's storyline. Like in the original game, the player controls Gordon Freeman, a theoretical physicist working at the Black Mesa Research Facility. He is tasked to place a sample of anomalous material into an Anti-Mass Spectrometer for analysis, using the Mark IV Hazardous Environment Suit (HEV Suit) to do so safely. However, the sample causes a "resonance cascade", devastating the facility and creating an interdimensional rift to an alien dimension called Xen, bringing its alien creatures to Earth. Freeman survives the incident, finds other survivors, and is tasked to make his way to the surface to call for help. Upon reaching the surface, however, he finds that the facility is being cleansed of any and all biological organisms – human or alien – by the military. Freeman learns from the surviving scientists the only way to stop the alien invasion is to cross over to Xen, a border world connecting different universes, and destroy the entity called the Nihilanth keeping the rift open. Freeman is teleported to Xen, destroys the Nihilanth, and ends the alien invasion. He is then detained by the G-Man, a mysterious interdimensional agent who claims his "employers" wish to hire Freeman. If he accepts, Freeman is placed into stasis; if not, he is teleported to his death.
Pitolisant is an inverse agonist (antagonist) of the histamine H3 autoreceptor. As such, pitolisant is an antihistamine medication that also belongs to the class of CNS stimulants. Pitolisant is also considered a medication of eugeroic class, which means that it promotes wakefulness and alertness. Pitolisant is the first wakefulness-promoting agent that acts by blocking the H3 autoreceptor. Pitolisant has been shown to be effective and well-tolerated for the treatment of narcolepsy with or without cataplexy. Pitolisant is the only non-controlled anti-narcoleptic drug in the United States. It has shown minimal abuse risk in studies. Blocking the histamine H3 autoreceptor increases the activity of histamine neurons in the brain. The H3 autoreceptors regulate histaminergic activity in the central nervous system (and to a lesser extent, the peripheral nervous system) by inhibiting histamine biosynthesis and release upon binding to endogenous histamine. By preventing the binding of endogenous histamine at the H3, as well as producing a response opposite to that of endogenous histamine at the receptor (inverse agonism), pitolisant enhances histaminergic activity in the brain.
== Macromolecules in nature == Proteins are polymers of amino acids joined by peptide bonds. DNA and RNA are polymers of nucleotides joined by phosphodiester bonds. These nucleotides consist of a phosphate group, a sugar (ribose in the case of RNA, deoxyribose in the case of DNA), and a nucleotide base (either adenine, guanine, thymine, uracil, or cytosine, where thymine occurs only in DNA and uracil only in RNA). Polysaccharides (such as starch, cellulose, and chitin) are polymers of monosaccharides joined by glycosidic bonds. Some lipids (organic nonpolar molecules) are macromolecules, with a variety of different structures.
A notable excision was the removal of the Glen Grey and Herschel Districts, and their allocation to the newly independent Transkei, with the populations of the districts moving into the rest of Ciskei to retain their South African citizenship (which was subsequently lost when Ciskei became independent). By the 1970s, the South African government decided on the final boundaries of Ciskei, as a consolidated area, through the amalgamation of existing reserves allocated to Ciskei, and the purchase of intervening white-owned land. This amalgamation reduced the total length of Ciskei's borders, making them easier for the South African government to police, as well being an attempt to create a more viable area for the homeland.
Sources: en.wikipedia.org
Cephalosporins are a broad class of bactericidal antibiotics that include the β-lactam ring and share a structural similarity and mechanism of action with other β-lactam antibiotics (e.g. penicillins, carbapenems and monobactams). The cephalosporins (and other β-lactams) have the ability to kill bacteria by inhibiting essential steps in the bacterial cell wall synthesis which in the end results in osmotic lysis and death of the bacterial cell. Cephalosporins are widely used antibiotics because of their clinical efficiency and desirable safety profile. The cephalosporins are diverse in their antibacterial spectrum, water solubility, acid tolerability, oral bioavailability, biological half-life and other properties. Therefore, the cephalosporins can be further classified into generations depending on antibacterial activity, time of invention and structural basis.
In addition to writing fiction, Tolkien was an author of academic literary criticism. His seminal 1936 lecture, later published as an article, revolutionized the treatment of the Anglo-Saxon epic Beowulf by literary critics. The essay remains highly influential in the study of Old English literature to this day. Beowulf is one of the most significant influences upon Tolkien's later fiction, with major details of both The Hobbit and The Lord of the Rings being adapted from the poem.
With the destruction of the Zaporizhian Sich, a number of Ukrainian-speaking Eastern Orthodox Zaporozhian Cossacks fled to the territory under the control of the Ottoman Empire. Together with Cossacks of Greater Russian origin, as well as the vast majority of Old Believers and other people from "Greater Russia" (Muscovy), they settled in the area of the Danube river, and founded a new Sich. Many Ukrainian peasants and adventurers later joined the Danubian Sich. While Ukrainian folklore remembers the Danubian Sich, other new siches of Loyal Zaporozhians on the Bug and Dniester rivers did not achieve such fame. Other Cossacks settled on the Tisa river in the Austrian Empire, also forming a new Sich. During the Cossack sojourn under Turkish rule, a new host was founded that numbered around 12,000 people by the end of 1778. Cossack settlement on the Russian border was approved by the Ottoman Empire after the Cossacks officially vowed to serve the sultan. Yet internal conflict, and the political maneuvering of the Russian Empire led to splits among the Cossacks. Some of the runaway Cossacks returned to Russia, where the Russian army used them to form new military bodies that also incorporated Greeks, Albanians and Crimean Tatars. After the Russo-Turkish war of 1787–1792, most of these Cossacks were absorbed into the Black Sea Cossack Host together with Loyal Zaporozhians. Most of the remaining Cossacks who had stayed in the Danube Delta returned to Russia in 1828. They settled in the area north of the Azov Sea, becoming known as the Azov Cossacks.
=== Raw materials === There are roughly 13,000 compounds used in China and over 100,000 TCM recipes recorded in the ancient literature. Plant elements and extracts are by far the most common elements used. In the classic Handbook of Traditional Drugs from 1941, 517 drugs were listed – out of these, 45 were animal parts, and 30 were minerals.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Sources: en.wikipedia.org
The letters BPC stand for body protection compound. The number 157 refers to a specific fragment designation from early work on gastric proteins. The full name is a label for a synthetic fifteen-amino-acid peptide rather than a naturally isolated drug.
No. The gastric protein is larger, while BPC-157 is a short fragment sequence. The peptide is produced synthetically for research use. The relationship is one of sequence origin, not chemical identity.
It is most often supplied as a lyophilized powder, frequently as the acetate salt. The powder is reconstituted with water or a buffer before use. Free-base and other salt forms also exist but are less common in catalogs.
It is a synthetic peptide. Its design was inspired by a fragment of a protein found in human gastric juice, but the fifteen-amino-acid molecule itself is made in a laboratory and is not a normal component of food or of human tissue in appreciable amounts.